- MX2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Supplier Product Page
- NBP1-81018
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- MX2
- This antibody was developed against Recombinant Protein corresponding to amino acids: PYRRRSQFSS RKYLKKEMNS FQQQPPPFGT VPPQMMFPPN WQGAEKDAAF LAKDFNFLTL NNQPPPGNRS QPRAMG
- Rabbit
- Human
- MXB
- 0.1 ml (also 25 ul)
- MX dynamin like GTPase 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 82 kDa
- Primary Antibodies
- Immunology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Specifications/Features
Available conjugates: Unconjugated